PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000060G1310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SRS
Protein Properties Length: 293aa    MW: 30016.3 Da    PI: 8.5747
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000060G1310genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702212.51e-65842223153
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                       g++sCqdCGnqakkdC+h RCRtCCksrgf CathvkstWvpa+krrerqqqlaa++++    a+++ +kr+r           st++ss+++
  PH01000060G1310  84 GGGVSCQDCGNQAKKDCTHLRCRTCCKSRGFACATHVKSTWVPASKRRERQQQLAALAAS----ASRDPTKRPRAR--------PSTTTSSGDQ 165
                      5789***************************************************98544....466788888864........5667788999 PP

           DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                      ++ + ++++P+evsseavfrcvr++ vd++e+e+aYqt++sigGhvfkGiL+d G++
  PH01000060G1310 166 QMVTVAQRFPREVSSEAVFRCVRLGPVDQAEAEVAYQTTISIGGHVFKGILHDVGPD 222
                      99999**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-6186222IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.9E-2688130IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.2E-22173221IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAGFPLGGGS SREHPAPSVP PVHPSDASSF LYATRGSSFQ LWQQQEQQPF YASNIIRFAD  60
DAPAAPSLAG ASSSSSRGMP AGGGGGVSCQ DCGNQAKKDC THLRCRTCCK SRGFACATHV  120
KSTWVPASKR RERQQQLAAL AASASRDPTK RPRARPSTTT SSGDQQMVTV AQRFPREVSS  180
EAVFRCVRLG PVDQAEAEVA YQTTISIGGH VFKGILHDVG PDALAAAGGG GGGDDYHYGS  240
SPSTAAAGEA GGGGAGGNII VSSAVVMDPY PTPGPYGAFP AGAPFFHGHP RP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412851e-126AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
GenBankAP0053141e-126AP005314.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0515E01.
GenBankAP0055671e-126AP005567.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1254_E07.
GenBankAP0149651e-126AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-126CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611315.11e-129PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA0A0E0EU541e-130A0A0E0EU54_9ORYZ; Uncharacterized protein
STRINGBGIOSGA029388-PA1e-129(Oryza sativa Indica Group)
STRINGLOC_Os09g36160.11e-129(Oryza sativa Japonica Group)
STRINGORGLA09G0136300.11e-129(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.13e-42Lateral root primordium (LRP) protein-related